Lineage for d5e3jb_ (5e3j B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855822Species Acinetobacter baumannii [TaxId:557600] [316905] (1 PDB entry)
  8. 2855824Domain d5e3jb_: 5e3j B: [316906]
    automated match to d5dcla_

Details for d5e3jb_

PDB Entry: 5e3j (more details), 2.1 Å

PDB Description: the response regulator rsta is a potential drug target for acinetobacter baumannii
PDB Compounds: (B:) Response regulator RstA

SCOPe Domain Sequences for d5e3jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e3jb_ c.23.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 557600]}
klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrrt

SCOPe Domain Coordinates for d5e3jb_:

Click to download the PDB-style file with coordinates for d5e3jb_.
(The format of our PDB-style files is described here.)

Timeline for d5e3jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5e3ja_