Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Acinetobacter baumannii [TaxId:557600] [316905] (1 PDB entry) |
Domain d5e3jb_: 5e3j B: [316906] automated match to d5dcla_ |
PDB Entry: 5e3j (more details), 2.1 Å
SCOPe Domain Sequences for d5e3jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e3jb_ c.23.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 557600]} klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrrt
Timeline for d5e3jb_: