Lineage for d5e0ha1 (5e0h A:1-173)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2798102Species Norwalk virus [TaxId:524364] [313606] (14 PDB entries)
  8. 2798111Domain d5e0ha1: 5e0h A:1-173 [316902]
    Other proteins in same PDB: d5e0ha2, d5e0hb2
    automated match to d2fyqa_
    complexed with 5lh, gol

Details for d5e0ha1

PDB Entry: 5e0h (more details), 1.95 Å

PDB Description: 1.95 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (18-mer) inhibitor
PDB Compounds: (A:) Norovirus 3C-like protease

SCOPe Domain Sequences for d5e0ha1:

Sequence, based on SEQRES records: (download)

>d5e0ha1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Sequence, based on observed residues (ATOM records): (download)

>d5e0ha1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lldlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

SCOPe Domain Coordinates for d5e0ha1:

Click to download the PDB-style file with coordinates for d5e0ha1.
(The format of our PDB-style files is described here.)

Timeline for d5e0ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5e0ha2