Lineage for d5dw4b1 (5dw4 B:2-229)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922594Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2922595Protein automated matches [191112] (17 species)
    not a true protein
  7. 2922596Species Acetobacter aceti [TaxId:1457393] [316891] (2 PDB entries)
  8. 2922598Domain d5dw4b1: 5dw4 B:2-229 [316892]
    Other proteins in same PDB: d5dw4a3
    automated match to d4eu3a1
    complexed with act, imd

Details for d5dw4b1

PDB Entry: 5dw4 (more details), 1.62 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6) bound to acetate
PDB Compounds: (B:) Succinyl-CoA:acetate CoA-transferase

SCOPe Domain Sequences for d5dw4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dw4b1 c.124.1.0 (B:2-229) automated matches {Acetobacter aceti [TaxId: 1457393]}
terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrn

SCOPe Domain Coordinates for d5dw4b1:

Click to download the PDB-style file with coordinates for d5dw4b1.
(The format of our PDB-style files is described here.)

Timeline for d5dw4b1: