Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases |
Family d.160.1.0: automated matches [191429] (1 protein) not a true family |
Protein automated matches [190617] (6 species) not a true protein |
Species Medicago truncatula [TaxId:3880] [316076] (4 PDB entries) |
Domain d5h8lm_: 5h8l M: [316863] automated match to d5h8lp_ complexed with edo, gol, peg, put; mutant |
PDB Entry: 5h8l (more details), 2.29 Å
SCOPe Domain Sequences for d5h8lm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h8lm_ d.160.1.0 (M:) automated matches {Medicago truncatula [TaxId: 3880]} kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi pdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfyptai gsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiag ptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
Timeline for d5h8lm_: