Lineage for d5h8lm_ (5h8l M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998496Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998497Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) (S)
    Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases
  5. 2998570Family d.160.1.0: automated matches [191429] (1 protein)
    not a true family
  6. 2998571Protein automated matches [190617] (6 species)
    not a true protein
  7. 2998577Species Medicago truncatula [TaxId:3880] [316076] (4 PDB entries)
  8. 2998622Domain d5h8lm_: 5h8l M: [316863]
    automated match to d5h8lp_
    complexed with edo, gol, peg, put; mutant

Details for d5h8lm_

PDB Entry: 5h8l (more details), 2.29 Å

PDB Description: crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine
PDB Compounds: (M:) N-carbamoylputrescine amidohydrolase

SCOPe Domain Sequences for d5h8lm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h8lm_ d.160.1.0 (M:) automated matches {Medicago truncatula [TaxId: 3880]}
kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
pdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfyptai
gsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiag
ptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl

SCOPe Domain Coordinates for d5h8lm_:

Click to download the PDB-style file with coordinates for d5h8lm_.
(The format of our PDB-style files is described here.)

Timeline for d5h8lm_: