SCOPe 2.06: Domain d5i71c1: 5i71 C:21-127

Lineage for d5i71c1 (5i71 C:21-127)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d5i71c1: 5i71 C:21-127 [316840]
   Other proteins in same PDB: d5i71c2
   automated match to d1a5fl1
   complexed with 68p, clr, d12, hex, na, nag

Details for d5i71c1

PDB Entry: 5i71, 3.15 Å

PDB Description: x-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central site

PDB Compounds: (C:) 8B6 antibody, light chain

SCOPe Domain Sequences for d5i71c1:

Sequence; same for both SEQRES and ATOM records:

>d5i71c1 b.1.1.0 (C:21-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyrytgvpd
rftgsgsgtdftftissvqaedlavyycqqhysiprtfgggtkleik

Timeline for d5i71c1:

• d5i71c1 is new in SCOPe 2.06-stable
  
• d5i71c1 appears in SCOPe 2.07
  
• d5i71c1 appears in the current release, SCOPe 2.08