Class b: All beta proteins [48724] (177 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein automated matches [193245] (14 species) not a true protein |
Species Influenza a virus (a/northern pintail/washington/40964/2014(h5n2)) [TaxId:1589662] [316773] (1 PDB entry) |
Domain d5huka1: 5huk A:83-469 [316831] Other proteins in same PDB: d5huka2, d5hukb2, d5hukc2, d5hukd2 automated match to d4gzpa_ complexed with bma, ca, man, nag |
PDB Entry: 5huk (more details), 2.45 Å
SCOPe Domain Sequences for d5huka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5huka1 b.68.1.1 (A:83-469) automated matches {Influenza a virus (a/northern pintail/washington/40964/2014(h5n2)) [TaxId: 1589662]} eyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscspgkcyqfalgqgttlnn khsngtihdriphrtllmselgvpfhlgtkqvciawsssschdgkawlhvcvtgddrnat asfiydgmladsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfikegki vhisplsgsaqhieecscyprypdvrcvcrdnwkgsnrpvidinmadysidssyvcsglv gdtprnddsssssncrdpnnergnpgvkgwafdngndvwmgrtisedsrsgyetfrvtdg wttansksqvnrqiivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsns ivvfcgtsgtygtgswpdganinfmpi
Timeline for d5huka1: