SCOPe 2.06: Domain d5huka1: 5huk A:83-469

Lineage for d5huka1 (5huk A:83-469)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein automated matches [193245] (14 species)
   not a true protein

7. Species Influenza a virus (a/northern pintail/washington/40964/2014(h5n2)) [TaxId:1589662] [316773] (1 PDB entry)

8. Domain d5huka1: 5huk A:83-469 [316831]
   Other proteins in same PDB: d5huka2, d5hukb2, d5hukc2, d5hukd2
   automated match to d4gzpa_
   complexed with bma, ca, man, nag

Details for d5huka1

PDB Entry: 5huk, 2.45 Å

PDB Description: the crystal structure of neuraminidase from a/northern pintail/washington/40964/2014 influenza virus

PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d5huka1:

Sequence; same for both SEQRES and ATOM records:

>d5huka1 b.68.1.1 (A:83-469) automated matches {Influenza a virus (a/northern pintail/washington/40964/2014(h5n2)) [TaxId: 1589662]}
eyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscspgkcyqfalgqgttlnn
khsngtihdriphrtllmselgvpfhlgtkqvciawsssschdgkawlhvcvtgddrnat
asfiydgmladsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfikegki
vhisplsgsaqhieecscyprypdvrcvcrdnwkgsnrpvidinmadysidssyvcsglv
gdtprnddsssssncrdpnnergnpgvkgwafdngndvwmgrtisedsrsgyetfrvtdg
wttansksqvnrqiivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsns
ivvfcgtsgtygtgswpdganinfmpi

Timeline for d5huka1:

• d5huka1 is new in SCOPe 2.06-stable
  
• d5huka1 appears in SCOPe 2.07
  
• d5huka1 appears in the current release, SCOPe 2.08