Lineage for d5jaya1 (5jay A:1-389)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (141 species)
    not a true protein
  7. 2472324Species Burkholderia xenovorans [TaxId:266265] [316123] (1 PDB entry)
  8. 2472325Domain d5jaya1: 5jay A:1-389 [316829]
    Other proteins in same PDB: d5jaya2
    automated match to d3tqxa_

Details for d5jaya1

PDB Entry: 5jay (more details), 1.75 Å

PDB Description: crystal structure of an 8-amino-7-oxononanoate synthase from burkholderia xenovorans
PDB Compounds: (A:) 8-amino-7-oxononanoate synthase

SCOPe Domain Sequences for d5jaya1:

Sequence, based on SEQRES records: (download)

>d5jaya1 c.67.1.0 (A:1-389) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mhlldtlaeglkeidarglrrrrrtadtpcaahmtvdgraiigfasndylglaahpqlia
aiaegaqrygagsggshllgghsrahaqleddlaefvggfvenaralyfstgymanlatl
talagrgttlfsdalnhaslidgarlsradvqiyphcdtdalsamleasdadvkvivsdt
vfsmdgdiaplprllelaeqhgawlivddahgfgvlgpqgrgaiaqaalrspnlisigtl
dkaagvsgafvaahetviewlvqrarpyifttasvpaaahavsaslriiggeegdarrah
lqqligrtramlkatpwlpvdshtavqpliigandatleiaatldraglwvpairpptvp
tgtsrlrislsaahsqadldrleaglqql

Sequence, based on observed residues (ATOM records): (download)

>d5jaya1 c.67.1.0 (A:1-389) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mhlldtlaeglkeidarglrrrrrtadtpcaahmtvdgraiigfasndylglaahpqlia
aiaegaqrygagsghsrahaqleddlaefvggfvenaralyfstgymanlatltalagrg
ttlfsdalnhaslidgarlsradvqiyphcdtdalsamleasdadvkvivsdtvfsmdgd
iaplprllelaeqhgawlivddahgfgvlgpqgrgaiaqaalrspnlisigtldkaagvs
gafvaahetviewlvqrarpyifttasvpaaahavsaslriiggeegdarrahlqqligr
tramlkatpwlpvdshtavqpliigandatleiaatldraglwvpairpptvptgtsrlr
islsaahsqadldrleaglqql

SCOPe Domain Coordinates for d5jaya1:

Click to download the PDB-style file with coordinates for d5jaya1.
(The format of our PDB-style files is described here.)

Timeline for d5jaya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jaya2
View in 3D
Domains from other chains:
(mouse over for more information)
d5jayb_