Lineage for d5j3ua2 (5j3u A:279-405)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816902Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2816903Protein automated matches [226927] (20 species)
    not a true protein
  7. 2817010Species Toxoplasma gondii [TaxId:5811] [316116] (1 PDB entry)
  8. 2817012Domain d5j3ua2: 5j3u A:279-405 [316825]
    Other proteins in same PDB: d5j3ua3
    automated match to d4jv4a2
    complexed with cmp, gol

Details for d5j3ua2

PDB Entry: 5j3u (more details), 1.8 Å

PDB Description: co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp
PDB Compounds: (A:) Protein Kinase A

SCOPe Domain Sequences for d5j3ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j3ua2 b.82.3.0 (A:279-405) automated matches {Toxoplasma gondii [TaxId: 5811]}
dsflksvhildgmdayergkvadalrtemftdgayivrqgelgdvfyiveegsavatksf
gpgqppievkkyqagdyfgelalineepraanviahgickvaclerksfkrlmgsvqdll
skkasey

SCOPe Domain Coordinates for d5j3ua2:

Click to download the PDB-style file with coordinates for d5j3ua2.
(The format of our PDB-style files is described here.)

Timeline for d5j3ua2: