Lineage for d5j8na1 (5j8n A:2-258)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548661Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2548662Protein automated matches [190734] (13 species)
    not a true protein
  7. 2548668Species Methanosarcina mazei [TaxId:192952] [316349] (1 PDB entry)
  8. 2548669Domain d5j8na1: 5j8n A:2-258 [316820]
    Other proteins in same PDB: d5j8na2
    automated match to d2jc5a_
    complexed with mg, pg4

Details for d5j8na1

PDB Entry: 5j8n (more details), 1.44 Å

PDB Description: exonuclease iii homologue mm3148 from methanosarcina mazei
PDB Compounds: (A:) exodeoxyribonuclease III

SCOPe Domain Sequences for d5j8na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j8na1 d.151.1.0 (A:2-258) automated matches {Methanosarcina mazei [TaxId: 192952]}
aehynliswnvnglraavkkgfldlllehrfdivcvqetkvsqdklprevkniqgyynyf
vsaeqngysgvgtfsknkpiklekgmgievfdregrflrtdyedfvllniyfpngkmsqe
rlgykmafydafldyanalksegkklvicgdvntahkeidlarpkqnemisgflpeeraw
mdkflaagyldsfrmfnpeggnyswwsyrtgarsrnvgwrldyvfvsenlrenvksasiy
peimgsdhcpvglelef

SCOPe Domain Coordinates for d5j8na1:

Click to download the PDB-style file with coordinates for d5j8na1.
(The format of our PDB-style files is described here.)

Timeline for d5j8na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j8na2