SCOP 1.57: Domain d1c3oa3: 1c3o A:1-127

Lineage for d1c3oa3 (1c3o A:1-127)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)

7. Species Escherichia coli [TaxId:562] [52451] (7 PDB entries)

8. Domain d1c3oa3: 1c3o A:1-127 [31681]
   Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og1, d1c3og2, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2

Details for d1c3oa3

PDB Entry: 1c3o, 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

SCOP Domain Sequences for d1c3oa3:

Sequence; same for both SEQRES and ATOM records:

>d1c3oa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

Timeline for d1c3oa3:

• d1c3oa3 first appeared (with stable ids) in SCOP 1.55
  
• d1c3oa3 appears in SCOP 1.59
  
• d1c3oa3 appears in the current release, SCOPe 2.08