![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
![]() | Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
![]() | Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
![]() | Protein automated matches [226933] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225235] (6 PDB entries) |
![]() | Domain d5ibkd2: 5ibk D:83-160 [316801] Other proteins in same PDB: d5ibka1, d5ibka3, d5ibkc_, d5ibkd1, d5ibkf_ automated match to d3wsob2 |
PDB Entry: 5ibk (more details), 2.5 Å
SCOPe Domain Sequences for d5ibkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ibkd2 a.157.1.1 (D:83-160) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnik ndfteeeeaqvrkenqwc
Timeline for d5ibkd2: