Lineage for d1cs0e4 (1cs0 E:556-676)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121291Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 121292Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 121293Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 121302Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)
  7. 121303Species Escherichia coli [TaxId:562] [52451] (8 PDB entries)
  8. 121317Domain d1cs0e4: 1cs0 E:556-676 [31678]
    Other proteins in same PDB: d1cs0a1, d1cs0a2, d1cs0a5, d1cs0a6, d1cs0b1, d1cs0b2, d1cs0c1, d1cs0c2, d1cs0c5, d1cs0c6, d1cs0d1, d1cs0d2, d1cs0e1, d1cs0e2, d1cs0e5, d1cs0e6, d1cs0f1, d1cs0f2, d1cs0g1, d1cs0g2, d1cs0g5, d1cs0g6, d1cs0h1, d1cs0h2

Details for d1cs0e4

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde

SCOP Domain Sequences for d1cs0e4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs0e4 c.30.1.1 (E:556-676) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOP Domain Coordinates for d1cs0e4:

Click to download the PDB-style file with coordinates for d1cs0e4.
(The format of our PDB-style files is described here.)

Timeline for d1cs0e4: