SCOPe 2.08: Domain d1cs0e4: 1cs0 E:556-676

Lineage for d1cs0e4 (1cs0 E:556-676)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
   duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains

7. Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
   Uniprot P00968

8. Domain d1cs0e4: 1cs0 E:556-676 [31678]
   Other proteins in same PDB: d1cs0a1, d1cs0a2, d1cs0a5, d1cs0a6, d1cs0b1, d1cs0b2, d1cs0c1, d1cs0c2, d1cs0c5, d1cs0c6, d1cs0d1, d1cs0d2, d1cs0e1, d1cs0e2, d1cs0e5, d1cs0e6, d1cs0f1, d1cs0f2, d1cs0g1, d1cs0g2, d1cs0g5, d1cs0g6, d1cs0h1, d1cs0h2
   complexed with adp, cl, k, mn, net, orn, po4

Details for d1cs0e4

PDB Entry: 1cs0, 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde

PDB Compounds: (E:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1cs0e4:

Sequence; same for both SEQRES and ATOM records:

>d1cs0e4 c.30.1.1 (E:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

Timeline for d1cs0e4:

• d1cs0e4 first appeared (with stable ids) in SCOP 1.55
  
• d1cs0e4 appears in SCOPe 2.07