Lineage for d5hpld1 (5hpl D:2-77)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932583Domain d5hpld1: 5hpl D:2-77 [316741]
    Other proteins in same PDB: d5hpla_, d5hplb_, d5hplc2, d5hpld2
    automated match to d4bbnf_

Details for d5hpld1

PDB Entry: 5hpl (more details), 2.31 Å

PDB Description: system-wide modulation of hect e3 ligases with selective ubiquitin variant probes: rsp5 and ubv r5.4
PDB Compounds: (D:) Ubiquitin variant R5.4

SCOPe Domain Sequences for d5hpld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpld1 d.15.1.1 (D:2-77) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qifvktptrksislevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyni
qkestlhlvlrlpgti

SCOPe Domain Coordinates for d5hpld1:

Click to download the PDB-style file with coordinates for d5hpld1.
(The format of our PDB-style files is described here.)

Timeline for d5hpld1: