Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) automatically mapped to Pfam PF00632 |
Family d.148.1.0: automated matches [227207] (1 protein) not a true family |
Protein automated matches [226939] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225255] (18 PDB entries) |
Domain d5hpka1: 5hpk A:574-949 [316732] Other proteins in same PDB: d5hpka2, d5hpkb1, d5hpkb2 automated match to d5c7jb_ |
PDB Entry: 5hpk (more details), 2.43 Å
SCOPe Domain Sequences for d5hpka1:
Sequence, based on SEQRES records: (download)
>d5hpka1 d.148.1.0 (A:574-949) automated matches {Human (Homo sapiens) [TaxId: 9606]} srefkqkydyfrkklkkpadipnrfemklhrnnifeesyrrimsvkrpdvlkarlwiefe sekgldyggvarewffllskemfnpyyglfeysatdnytlqinpnsglcnedhlsyftfi grvaglavfhgklldgffirpfykmmlgkqitlndmesvdseyynslkwilendpteldl mfcideenfgqtyqvdlkpngseimvtnenkreyidlviqwrfvnrvqkqmnaflegfte llpidlikifdenelellmcglgdvdvndwrqhsiykngycpnhpviqwfwkavllmdae krirllqfvtgtsrvpmngfaelygsngpqlftieqwgspeklprahtcfnrldlppyet fedlrekllmavenaq
>d5hpka1 d.148.1.0 (A:574-949) automated matches {Human (Homo sapiens) [TaxId: 9606]} srefkqkydyfrkklkkpadipnrfemklhrnnifeesyrrimsvkrpdvlkarlwiefe dyggvarewffllskemfnpyyglfeysatdnytlqinpnsglcnedhlsyftfigrvag lavfhgklldgffirpfykmmlgkqitlndmesvdseyynslkwilendpteldlmfcid eenfgqtyqvdlkpngseimvtnenkreyidlviqwrfvnrvqkqmnaflegftellpid likifdenelellmcglgdvdvndwrqhsiykngycpnhpviqwfwkavllmdaekrirl lqfvtgtsrvpmngfaelygsngpqlftieqwgspeklprahtcfnrldlppyetfedlr ekllmavenaq
Timeline for d5hpka1: