Lineage for d5hpkb1 (5hpk B:2-77)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2178112Protein automated matches [190118] (12 species)
    not a true protein
  7. 2178143Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries)
  8. 2178268Domain d5hpkb1: 5hpk B:2-77 [316731]
    Other proteins in same PDB: d5hpka1, d5hpka2, d5hpkb2
    automated match to d3rula_

Details for d5hpkb1

PDB Entry: 5hpk (more details), 2.43 Å

PDB Description: system-wide modulation of hect e3 ligases with selective ubiquitin variant probes: nedd4l and ubv nl.1
PDB Compounds: (B:) Ubiquitin variant NL.1

SCOPe Domain Sequences for d5hpkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpkb1 d.15.1.1 (B:2-77) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rifvrtptrktitlevepsdtienvkakiqdkegippdqqvlifagnrledgrtlsdyni
pkestlylfmrlrgle

SCOPe Domain Coordinates for d5hpkb1:

Click to download the PDB-style file with coordinates for d5hpkb1.
(The format of our PDB-style files is described here.)

Timeline for d5hpkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hpkb2