Lineage for d5fkoa1 (5fko A:3-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306190Species Escherichia coli [TaxId:562] [226228] (11 PDB entries)
  8. 2306200Domain d5fkoa1: 5fko A:3-67 [316716]
    Other proteins in same PDB: d5fkoa2, d5fkoa3
    automated match to d1a6ia1
    complexed with cl, mg, tdc; mutant

Details for d5fkoa1

PDB Entry: 5fko (more details), 1.85 Å

PDB Description: tetr(d) e147a mutant in complex with anhydrotetracycline and magnesium
PDB Compounds: (A:) tetracycline repressor, class d, e147a mutant

SCOPe Domain Sequences for d5fkoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fkoa1 a.4.1.0 (A:3-67) automated matches {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

SCOPe Domain Coordinates for d5fkoa1:

Click to download the PDB-style file with coordinates for d5fkoa1.
(The format of our PDB-style files is described here.)

Timeline for d5fkoa1: