Class a: All alpha proteins [46456] (290 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
Protein automated matches [191142] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries) |
Domain d5ethb_: 5eth B: [316648] automated match to d4zoma_ complexed with 5rt |
PDB Entry: 5eth (more details), 2.8 Å
SCOPe Domain Sequences for d5ethb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ethb_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl elafhhhlckthrqsilaklppkgklrslcsqhverlqifq
Timeline for d5ethb_: