Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Exiguobacterium antarcticum [TaxId:1087448] [315226] (2 PDB entries) |
Domain d5dt5d_: 5dt5 D: [316638] automated match to d5dt7d_ complexed with so4 |
PDB Entry: 5dt5 (more details), 2.24 Å
SCOPe Domain Sequences for d5dt5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dt5d_ c.1.8.0 (D:) automated matches {Exiguobacterium antarcticum [TaxId: 1087448]} fapnfvfgtatssyqiegahdeggrtpsiwdtfcdtdgkvfekhngdvacdhyhrfeedi qhikqlgvdtyrfsiawprifpskgqfnpegmafyktlatrlqeegikpavtlyhwdlpm waheeggwvnrdsvdwfldfarvcfeeldgivdswithnepwcagflsyhlgqhapghtd mneavravhhmllshgkavemlkgefnsatpigitlnlapkyaktdsindqiamnnadgy anrwfldpifkgqypvdmmnlfskyvhtydfihagdlatistpcdffginfysrnlvefs aasdflhkdaysdydktgmgwdiapsefkdlirrlraeytdlpiyitengaafddqlvdg kihdqnridyvaqhlqavsdlndegmniagyylwslldnfewsfgydkrfgiiyvdfdtq eriwkdsahwyanviqthkaalp
Timeline for d5dt5d_: