Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) contains a single copy of this fold and an extra beta-strand at the C-terminus |
Family d.129.2.0: automated matches [254315] (1 protein) not a true family |
Protein automated matches [254722] (3 species) not a true protein |
Species Homo sapiens [TaxId:9606] [316258] (5 PDB entries) |
Domain d5epcb4: 5epc B:422-562 [316632] Other proteins in same PDB: d5epca1, d5epca2, d5epca3, d5epca5, d5epcb1, d5epcb2, d5epcb3, d5epcb5 automated match to d5f9ca4 complexed with gol, mg, so4 |
PDB Entry: 5epc (more details), 1.85 Å
SCOPe Domain Sequences for d5epcb4:
Sequence, based on SEQRES records: (download)
>d5epcb4 d.129.2.0 (B:422-562) automated matches {Homo sapiens [TaxId: 9606]} rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis ialkvsqlqertgrtaptvit
>d5epcb4 d.129.2.0 (B:422-562) automated matches {Homo sapiens [TaxId: 9606]} rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd gsisrnqglrliftdgsrivfrlsatirlyidsyekdvakinqdpqvmlaplisialkvs qlqertgrtaptvit
Timeline for d5epcb4: