Lineage for d5epcb4 (5epc B:422-562)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214851Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2214890Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2214891Protein automated matches [254722] (3 species)
    not a true protein
  7. 2214892Species Homo sapiens [TaxId:9606] [316258] (5 PDB entries)
  8. 2214896Domain d5epcb4: 5epc B:422-562 [316632]
    Other proteins in same PDB: d5epca1, d5epca2, d5epca3, d5epca5, d5epcb1, d5epcb2, d5epcb3, d5epcb5
    automated match to d5f9ca4
    complexed with gol, mg, so4

Details for d5epcb4

PDB Entry: 5epc (more details), 1.85 Å

PDB Description: crystal structure of wild-type human phosphoglucomutase 1
PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5epcb4:

Sequence, based on SEQRES records: (download)

>d5epcb4 d.129.2.0 (B:422-562) automated matches {Homo sapiens [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

Sequence, based on observed residues (ATOM records): (download)

>d5epcb4 d.129.2.0 (B:422-562) automated matches {Homo sapiens [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsatirlyidsyekdvakinqdpqvmlaplisialkvs
qlqertgrtaptvit

SCOPe Domain Coordinates for d5epcb4:

Click to download the PDB-style file with coordinates for d5epcb4.
(The format of our PDB-style files is described here.)

Timeline for d5epcb4: