SCOPe 2.08: Domain d5enja1: 5enj A:1315-1435

Lineage for d5enja1 (5enj A:1315-1435)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5enja1: 5enj A:1315-1435 [316607]
   Other proteins in same PDB: d5enja2
   automated match to d3mb3a_
   complexed with 5q9, mg

Details for d5enja1

PDB Entry: 5enj, 1.63 Å

PDB Description: crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with compound-14 n11530 (sgc - diamond i04-1 fragment screening)

PDB Compounds: (A:) PH-interacting protein

SCOPe Domain Sequences for d5enja1:

Sequence; same for both SEQRES and ATOM records:

>d5enja1 a.29.2.0 (A:1315-1435) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretleagn
yespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfhkr
n

Timeline for d5enja1:

• d5enja1 first appeared in SCOPe 2.06
  
• d5enja1 appears in SCOPe 2.07