Lineage for d1a9xc4 (1a9x C:2556-2676)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1842745Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 1842807Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 1842808Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
    Uniprot P00968
  8. 1842812Domain d1a9xc4: 1a9x C:2556-2676 [31660]
    Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc2, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe2, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg5, d1a9xg6, d1a9xh1, d1a9xh2
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1a9xc4

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis
PDB Compounds: (C:) carbamoyl phosphate synthetase (large chain)

SCOPe Domain Sequences for d1a9xc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xc4 c.30.1.1 (C:2556-2676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOPe Domain Coordinates for d1a9xc4:

Click to download the PDB-style file with coordinates for d1a9xc4.
(The format of our PDB-style files is described here.)

Timeline for d1a9xc4: