Lineage for d5dt5h_ (5dt5 H:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095547Species Exiguobacterium antarcticum [TaxId:1087448] [315226] (2 PDB entries)
  8. 2095559Domain d5dt5h_: 5dt5 H: [316590]
    automated match to d5dt7d_
    complexed with so4

Details for d5dt5h_

PDB Entry: 5dt5 (more details), 2.24 Å

PDB Description: crystal structure of the gh1 beta-glucosidase from exiguobacterium antarcticum b7 in space group p21
PDB Compounds: (H:) Beta-glucosidase

SCOPe Domain Sequences for d5dt5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dt5h_ c.1.8.0 (H:) automated matches {Exiguobacterium antarcticum [TaxId: 1087448]}
fapnfvfgtatssyqiegahdeggrtpsiwdtfcdtdgkvfekhngdvacdhyhrfeedi
qhikqlgvdtyrfsiawprifpskgqfnpegmafyktlatrlqeegikpavtlyhwdlpm
waheeggwvnrdsvdwfldfarvcfeeldgivdswithnepwcagflsyhlgqhapghtd
mneavravhhmllshgkavemlkgefnsatpigitlnlapkyaktdsindqiamnnadgy
anrwfldpifkgqypvdmmnlfskyvhtydfihagdlatistpcdffginfysrnlvefs
aasdflhkdaysdydktgmgwdiapsefkdlirrlraeytdlpiyitengaafddqlvdg
kihdqnridyvaqhlqavsdlndegmniagyylwslldnfewsfgydkrfgiiyvdfdtq
eriwkdsahwyanviqthkaalp

SCOPe Domain Coordinates for d5dt5h_:

Click to download the PDB-style file with coordinates for d5dt5h_.
(The format of our PDB-style files is described here.)

Timeline for d5dt5h_: