Lineage for d5d3xa1 (5d3x A:245-406)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395025Species Human (Homo sapiens) [TaxId:9606] [186914] (63 PDB entries)
  8. 2395032Domain d5d3xa1: 5d3x A:245-406 [316581]
    Other proteins in same PDB: d5d3xa2, d5d3xb2
    automated match to d5d3yb_
    complexed with 4ip

Details for d5d3xa1

PDB Entry: 5d3x (more details), 1.69 Å

PDB Description: crystal structure of the p-rex1 ph domain with inositol-(1,3,4,5)- tetrakisphosphate bound
PDB Compounds: (A:) Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein

SCOPe Domain Sequences for d5d3xa1:

Sequence, based on SEQRES records: (download)

>d5d3xa1 b.55.1.0 (A:245-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eklealeqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrk
srvtgskkstkrtksingslyifrgrintevmevenvedgtadyhsngytvtngwkihnt
aknkwfvcmaktaeekqkwldaiirereqreslklgmerday

Sequence, based on observed residues (ATOM records): (download)

>d5d3xa1 b.55.1.0 (A:245-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eklealeqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrk
singslyifrgrintevmevenvedgtadyhsngytvtngwkihntaknkwfvcmaktae
ekqkwldaiirereqreslklgmerday

SCOPe Domain Coordinates for d5d3xa1:

Click to download the PDB-style file with coordinates for d5d3xa1.
(The format of our PDB-style files is described here.)

Timeline for d5d3xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d3xa2