Lineage for d5d3vb_ (5d3v B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395025Species Human (Homo sapiens) [TaxId:9606] [186914] (63 PDB entries)
  8. 2395044Domain d5d3vb_: 5d3v B: [316577]
    Other proteins in same PDB: d5d3va2
    automated match to d5d3yb_
    complexed with flc

Details for d5d3vb_

PDB Entry: 5d3v (more details), 1.85 Å

PDB Description: crystal structure of the p-rex1 ph domain with citrate bound
PDB Compounds: (B:) Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein

SCOPe Domain Sequences for d5d3vb_:

Sequence, based on SEQRES records: (download)

>d5d3vb_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klealeqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrks
rvtgskkstkrtksingslyifrgrintevmevenvedgtadyhsngytvtngwkihnta
knkwfvcmaktaeekqkwldaiirereqreslklg

Sequence, based on observed residues (ATOM records): (download)

>d5d3vb_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klealeqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrks
lyifrgrintevmevenvedgtadyhsngytvtngwkihntaknkwfvcmaktaeekqkw
ldaiirereqreslklg

SCOPe Domain Coordinates for d5d3vb_:

Click to download the PDB-style file with coordinates for d5d3vb_.
(The format of our PDB-style files is described here.)

Timeline for d5d3vb_: