SCOPe 2.08: Domain d5d27a1: 5d27 A:245-407

Lineage for d5d27a1 (5d27 A:245-407)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d5d27a1: 5d27 A:245-407 [316552]
   Other proteins in same PDB: d5d27a2
   automated match to d5d3yb_
   complexed with ni

Details for d5d27a1

PDB Entry: 5d27, 1.92 Å

PDB Description: crystal structure of the p-rex1 ph domain

PDB Compounds: (A:) Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein

SCOPe Domain Sequences for d5d27a1:

Sequence, based on SEQRES records:

>d5d27a1 b.55.1.0 (A:245-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eklealeqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrk
srvtgskkstkrtksingslyifrgrintevmevenvedgtadyhsngytvtngwkihnt
aknkwfvcmaktaeekqkwldaiirereqreslklgmerdayv

Sequence, based on observed residues (ATOM records):

>d5d27a1 b.55.1.0 (A:245-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eklealeqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrk
sksingslyifrgrintevmevenvedgtadyhsngytvtngwkihntaknkwfvcmakt
aeekqkwldaiirereqreslklgmerdayv

Timeline for d5d27a1:

• d5d27a1 first appeared in SCOPe 2.06
  
• d5d27a1 appears in SCOPe 2.07