SCOPe 2.08: Domain d5cuhb1: 5cuh B:107-269

Lineage for d5cuhb1 (5cuh B:107-269)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries)

8. Domain d5cuhb1: 5cuh B:107-269 [316540]
   Other proteins in same PDB: d5cuha2, d5cuhb2
   automated match to d3keka_
   complexed with ca, dms, edo, ltq, pgo, zn

Details for d5cuhb1

PDB Entry: 5cuh, 1.83 Å

PDB Description: crystal structure mmp-9 complexes with a constrained hydroxamate based inhibitor lt4

PDB Compounds: (B:) Matrix metalloproteinase-9,Matrix metalloproteinase-9

SCOPe Domain Sequences for d5cuhb1:

Sequence; same for both SEQRES and ATOM records:

>d5cuhb1 d.92.1.11 (B:107-269) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadi
viqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaah
efghalgldhssvpealmypmyrftegpplhkddvngirhlyg

Timeline for d5cuhb1:

• d5cuhb1 first appeared in SCOPe 2.06
  
• d5cuhb1 appears in SCOPe 2.07