SCOPe 2.06: Domain d5c7jc1: 5c7j C:2-73

Lineage for d5c7jc1 (5c7j C:2-73)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries)

8. Domain d5c7jc1: 5c7j C:2-73 [316516]
   Other proteins in same PDB: d5c7jc2, d5c7jd2
   automated match to d4bbnf_

Details for d5c7jc1

PDB Entry: 5c7j, 3 Å

PDB Description: crystal structure of nedd4 with a ub variant

PDB Compounds: (C:) Polyubiquitin-C

SCOPe Domain Sequences for d5c7jc1:

Sequence; same for both SEQRES and ATOM records:

>d5c7jc1 d.15.1.1 (C:2-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qifvktlagwgitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyni
rydsqlhlvgrl

Timeline for d5c7jc1:

• d5c7jc1 is new in SCOPe 2.06-stable
  
• d5c7jc1 appears in SCOPe 2.07
  
• d5c7jc1 appears in the current release, SCOPe 2.08