Lineage for d5c7jc1 (5c7j C:2-73)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501389Protein Ubiquitin [54238] (9 species)
  7. 2501491Species Human (Homo sapiens) [TaxId:9606] [54239] (296 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2501845Domain d5c7jc1: 5c7j C:2-73 [316516]
    Other proteins in same PDB: d5c7ja_, d5c7jb_, d5c7jc2, d5c7jd2
    automated match to d4bbnf_

Details for d5c7jc1

PDB Entry: 5c7j (more details), 3 Å

PDB Description: crystal structure of nedd4 with a ub variant
PDB Compounds: (C:) Polyubiquitin-C

SCOPe Domain Sequences for d5c7jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c7jc1 d.15.1.1 (C:2-73) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
qifvktlagwgitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyni
rydsqlhlvgrl

SCOPe Domain Coordinates for d5c7jc1:

Click to download the PDB-style file with coordinates for d5c7jc1.
(The format of our PDB-style files is described here.)

Timeline for d5c7jc1: