Lineage for d4uhka1 (4uhk A:2-123)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115227Species Escherichia coli [TaxId:83333] [315489] (3 PDB entries)
  8. 2115232Domain d4uhka1: 4uhk A:2-123 [316514]
    Other proteins in same PDB: d4uhka2, d4uhkb2, d4uhkc2
    automated match to d3gt7a_
    complexed with mg

Details for d4uhka1

PDB Entry: 4uhk (more details), 2.6 Å

PDB Description: crystal structure of the receiver domain of cpxr from e. coli (phosphorylated)
PDB Compounds: (A:) transcriptional regulatory protein cpxr

SCOPe Domain Sequences for d4uhka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhka1 c.23.1.0 (A:2-123) automated matches {Escherichia coli [TaxId: 83333]}
nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid
tlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshws
eq

SCOPe Domain Coordinates for d4uhka1:

Click to download the PDB-style file with coordinates for d4uhka1.
(The format of our PDB-style files is described here.)

Timeline for d4uhka1: