SCOPe 2.08: Domain d4uhka1: 4uhk A:2-123

Lineage for d4uhka1 (4uhk A:2-123)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [315489] (3 PDB entries)

8. Domain d4uhka1: 4uhk A:2-123 [316514]
   Other proteins in same PDB: d4uhka2, d4uhkb2, d4uhkc2
   automated match to d3gt7a_
   complexed with mg

Details for d4uhka1

PDB Entry: 4uhk, 2.6 Å

PDB Description: crystal structure of the receiver domain of cpxr from e. coli (phosphorylated)

PDB Compounds: (A:) transcriptional regulatory protein cpxr

SCOPe Domain Sequences for d4uhka1:

Sequence; same for both SEQRES and ATOM records:

>d4uhka1 c.23.1.0 (A:2-123) automated matches {Escherichia coli [TaxId: 83333]}
nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid
tlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshws
eq

Timeline for d4uhka1:

• d4uhka1 first appeared in SCOPe 2.06
  
• d4uhka1 appears in SCOPe 2.07