Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries) |
Domain d5aeaa1: 5aea A:1-97 [316500] Other proteins in same PDB: d5aeaa2, d5aeab2 automated match to d2ncma_ complexed with flc |
PDB Entry: 5aea (more details), 1.9 Å
SCOPe Domain Sequences for d5aeaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aeaa1 b.1.1.4 (A:1-97) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngekltpnqqrisvvwnddsss tltiynaniddagiykcvvtgedgseseatvnvkifq
Timeline for d5aeaa1: