SCOPe 2.08: Domain d4z4ja1: 4z4j A:1-390

Lineage for d4z4ja1 (4z4j A:1-390)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (23 species)
   not a true protein

7. Species Caldicellulosiruptor saccharolyticus [TaxId:351627] [315551] (3 PDB entries)

8. Domain d4z4ja1: 4z4j A:1-390 [316471]
   Other proteins in same PDB: d4z4ja2
   automated match to d3wkga_
   complexed with edo, ipa

Details for d4z4ja1

PDB Entry: 4z4j, 1.54 Å

PDB Description: crystal structure of cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus dsm 8903

PDB Compounds: (A:) Cellobiose 2-epimerase

SCOPe Domain Sequences for d4z4ja1:

Sequence; same for both SEQRES and ATOM records:

>d4z4ja1 a.102.1.0 (A:1-390) automated matches {Caldicellulosiruptor saccharolyticus [TaxId: 351627]}
mditrfkedlkahleekiipfwqslkddefggyygymdfnlnidrkaqkgcilnsrilwf
fsacynvlksekckemafhafeflknkfwdkeyeglfwsvshkgvpvdvtkhvyvqafgi
yglseyyeasgdeealhmakrlfeiletkckrengyteqfernwqekenrflsengvias
ktmnthlhvlesytnlyrllklddvyealewivrlfvdkiykkgtghfkvfcddnwneli
kavsyghdieaswlldqaakylkdeklkeeveklalevaqitlkeafdgqslinemiedr
idrskiwwveaetvvgffnayqktkeekyldaaiktwefikehlvdrrknsewlwkvned
leavnmpiveqwkcpyhngrmcleiikrvd

Timeline for d4z4ja1:

• d4z4ja1 first appeared in SCOPe 2.06
  
• d4z4ja1 appears in SCOPe 2.07