SCOPe 2.06: Domain d5c1tb2: 5c1t B:177-338

Lineage for d5c1tb2 (5c1t B:177-338)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Entamoeba histolytica [TaxId:5759] [316221] (2 PDB entries)

8. Domain d5c1tb2: 5c1t B:177-338 [316412]
   automated match to d2fu5d_
   complexed with gtp, mg

Details for d5c1tb2

PDB Entry: 5c1t, 2.8 Å

PDB Description: crystal structure of the gtp-bound wild type ehrabx3 from entamoeba histolytica

PDB Compounds: (B:) Small GTPase EhRabX3

SCOPe Domain Sequences for d5c1tb2:

Sequence, based on SEQRES records:

>d5c1tb2 c.37.1.0 (B:177-338) automated matches {Entamoeba histolytica [TaxId: 5759]}
cdikirmlmvgdqnvgkttfirkfalqdptghdfmnaittrfemekikyeiimidwgfyn
kllqtnpaisrtieailivyditneesfqnihrkyyplinnkfsdvagvivgyktdleaq
rkitmgdaltladwlgykyvemsskdtedhssiikalahsir

Sequence, based on observed residues (ATOM records):

>d5c1tb2 c.37.1.0 (B:177-338) automated matches {Entamoeba histolytica [TaxId: 5759]}
cdikirmlmvgdqnvgkttfirkfalqdpdfmnaittrfemekikyeiimidwgfynkll
qtnpaisrtieailivyditneesfqnihrkyylinnkfsdvagvivgktdleaqrkitm
gdltladwlgykyvemsskdtedhssiikalahsir

Timeline for d5c1tb2:

• d5c1tb2 is new in SCOPe 2.06-stable
  
• d5c1tb2 appears in SCOPe 2.07
  
• d5c1tb2 appears in the current release, SCOPe 2.08