Lineage for d1efvb1 (1efv B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178723Fold c.29: ETFP adenine nucleotide-binding domain-like [52430] (1 superfamily)
  4. 178724Superfamily c.29.1: ETFP adenine nucleotide-binding domain-like [52431] (2 families) (S)
  5. 178725Family c.29.1.1: Electron transfer flavoprotein, ETFP [52432] (1 protein)
  6. 178726Protein Electron transfer flavoprotein, ETFP [52433] (2 species)
  7. 178727Species Human (Homo sapiens) [TaxId:9606] [52434] (1 PDB entry)
  8. 178729Domain d1efvb1: 1efv B: [31634]
    Other proteins in same PDB: d1efva2

Details for d1efvb1

PDB Entry: 1efv (more details), 2.1 Å

PDB Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution

SCOP Domain Sequences for d1efvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efvb1 c.29.1.1 (B:) Electron transfer flavoprotein, ETFP {Human (Homo sapiens)}
lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpavvta
dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkvette
dlvaklkeigri

SCOP Domain Coordinates for d1efvb1:

Click to download the PDB-style file with coordinates for d1efvb1.
(The format of our PDB-style files is described here.)

Timeline for d1efvb1: