Lineage for d5c1sa2 (5c1s A:177-335)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452121Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [316221] (2 PDB entries)
  8. 2452127Domain d5c1sa2: 5c1s A:177-335 [316251]
    automated match to d2fu5d_
    complexed with gdp; mutant

Details for d5c1sa2

PDB Entry: 5c1s (more details), 3.1 Å

PDB Description: crystal structure of the gdp-bound fast hydrolyzing mutant (v71a/k73q) of ehrabx3 from entamoeba histolytica
PDB Compounds: (A:) Small GTPase EhRabX3

SCOPe Domain Sequences for d5c1sa2:

Sequence, based on SEQRES records: (download)

>d5c1sa2 c.37.1.0 (A:177-335) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
cdikirmlmvgdqnvgkttfirkfalqdptghdfmnaittrfemekikyeiimidwgfyn
kllqtnpaisrtieailivyditneesfqnihrkyyplinnkfsdvagvivgyktdleaq
rkitmgdaltladwlgykyvemsskdtedhssiikalah

Sequence, based on observed residues (ATOM records): (download)

>d5c1sa2 c.37.1.0 (A:177-335) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
cdikirmlmvgdqnvgkttkfalqdptghdfmnaittrfeekikyeiimidwgfynkllq
tnpaisrtieailivyditneesfqnihrkyyplinnkfsdvvgyktdleaqrkitmgda
ltladwlgykyvemsskdtedhssiikalah

SCOPe Domain Coordinates for d5c1sa2:

Click to download the PDB-style file with coordinates for d5c1sa2.
(The format of our PDB-style files is described here.)

Timeline for d5c1sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5c1sa1