Lineage for d1otp_2 (1otp 71-335)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22604Fold c.27: Pyrimidine nucleoside phosphorylase central domain [52417] (1 superfamily)
  4. 22605Superfamily c.27.1: Pyrimidine nucleoside phosphorylase central domain [52418] (1 family) (S)
  5. 22606Family c.27.1.1: Pyrimidine nucleoside phosphorylase central domain [52419] (2 proteins)
  6. 22611Protein Thymidine phosphorylase [52420] (1 species)
  7. 22612Species Escherichia coli [TaxId:562] [52421] (4 PDB entries)
  8. 22614Domain d1otp_2: 1otp 71-335 [31624]
    Other proteins in same PDB: d1otp_1, d1otp_3

Details for d1otp_2

PDB Entry: 1otp (more details), 2.8 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase

SCOP Domain Sequences for d1otp_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otp_2 c.27.1.1 (71-335) Thymidine phosphorylase {Escherichia coli}
dwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglghtggtldklesi
pgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsiplitasilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearaklqavldngkaa
evfgrmvaaqkgptdfvenyakylp

SCOP Domain Coordinates for d1otp_2:

Click to download the PDB-style file with coordinates for d1otp_2.
(The format of our PDB-style files is described here.)

Timeline for d1otp_2: