Lineage for d2tpt_2 (2tpt 71-335)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.27: Pyrimidine nucleoside phosphorylase central domain [52417] (1 superfamily) Superfamily c.27.1: Pyrimidine nucleoside phosphorylase central domain [52418] (1 family) 
Family c.27.1.1: Pyrimidine nucleoside phosphorylase central domain [52419] (2 proteins) 
Protein Thymidine phosphorylase [52420] (1 species) Species Escherichia coli [TaxId:562] [52421] (4 PDB entries) 
Domain d2tpt_2: 2tpt 71-335 [31623]
Other proteins in same PDB: d2tpt_1, d2tpt_3
Details for d2tpt_2
PDB Entry: 2tpt (more details), 2.6 Å
PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
SCOP Domain Sequences for d2tpt_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tpt_2 c.27.1.1 (71-335) Thymidine phosphorylase {Escherichia coli}
dwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglghtggtldklesi
pgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsiplitasilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearaklqavldngkaa
evfgrmvaaqkgptdfvenyakylp
SCOP Domain Coordinates for d2tpt_2:
Click to download the PDB-style file with coordinates for d2tpt_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tpt_2:
- d2tpt_2 first appeared (with stable ids) in SCOP 1.55
- d2tpt_2 appears in SCOP 1.59
- d2tpt_2 appears in the current release, SCOPe 2.08, called d2tpta2
View in 3D
