Lineage for d2tpt_2 (2tpt 71-335)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22604Fold c.27: Pyrimidine nucleoside phosphorylase central domain [52417] (1 superfamily)
  4. 22605Superfamily c.27.1: Pyrimidine nucleoside phosphorylase central domain [52418] (1 family) (S)
  5. 22606Family c.27.1.1: Pyrimidine nucleoside phosphorylase central domain [52419] (2 proteins)
  6. 22611Protein Thymidine phosphorylase [52420] (1 species)
  7. 22612Species Escherichia coli [TaxId:562] [52421] (4 PDB entries)
  8. 22613Domain d2tpt_2: 2tpt 71-335 [31623]
    Other proteins in same PDB: d2tpt_1, d2tpt_3

Details for d2tpt_2

PDB Entry: 2tpt (more details), 2.6 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase

SCOP Domain Sequences for d2tpt_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tpt_2 c.27.1.1 (71-335) Thymidine phosphorylase {Escherichia coli}
dwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglghtggtldklesi
pgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsiplitasilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearaklqavldngkaa
evfgrmvaaqkgptdfvenyakylp

SCOP Domain Coordinates for d2tpt_2:

Click to download the PDB-style file with coordinates for d2tpt_2.
(The format of our PDB-style files is described here.)

Timeline for d2tpt_2: