Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
Species Pyrococcus furiosus [TaxId:186497] [316219] (1 PDB entry) |
Domain d5auja2: 5auj A:128-247 [316226] automated match to d1isqa2 |
PDB Entry: 5auj (more details), 2.5 Å
SCOPe Domain Sequences for d5auja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5auja2 d.131.1.2 (A:128-247) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 186497]} lpftakvvvlgevlkdavkdaslvsdsikfiarenefimkaegetqeveikltledegll dievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllaprv
Timeline for d5auja2: