SCOPe 2.06: Domain d5auja2: 5auj A:128-247

Lineage for d5auja2 (5auj A:128-247)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Pyrococcus furiosus [TaxId:186497] [316219] (1 PDB entry)

8. Domain d5auja2: 5auj A:128-247 [316226]
   automated match to d1isqa2

Details for d5auja2

PDB Entry: 5auj, 2.5 Å

PDB Description: pyrococcus furiosus proliferating cell nuclear antigen (pcna) semet derivative

PDB Compounds: (A:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d5auja2:

Sequence; same for both SEQRES and ATOM records:

>d5auja2 d.131.1.2 (A:128-247) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 186497]}
lpftakvvvlgevlkdavkdaslvsdsikfiarenefimkaegetqeveikltledegll
dievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllaprv

Timeline for d5auja2:

• d5auja2 is new in SCOPe 2.06-stable
  
• d5auja2 appears in SCOPe 2.07
  
• d5auja2 appears in the current release, SCOPe 2.08