Lineage for d5auja2 (5auj A:128-247)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977029Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2977151Species Pyrococcus furiosus [TaxId:186497] [316219] (1 PDB entry)
  8. 2977153Domain d5auja2: 5auj A:128-247 [316226]
    automated match to d1isqa2

Details for d5auja2

PDB Entry: 5auj (more details), 2.5 Å

PDB Description: pyrococcus furiosus proliferating cell nuclear antigen (pcna) semet derivative
PDB Compounds: (A:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d5auja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5auja2 d.131.1.2 (A:128-247) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 186497]}
lpftakvvvlgevlkdavkdaslvsdsikfiarenefimkaegetqeveikltledegll
dievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllaprv

SCOPe Domain Coordinates for d5auja2:

Click to download the PDB-style file with coordinates for d5auja2.
(The format of our PDB-style files is described here.)

Timeline for d5auja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5auja1