Lineage for d5c16b1 (5c16 B:98-219)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395025Species Human (Homo sapiens) [TaxId:9606] [186914] (63 PDB entries)
  8. 2395053Domain d5c16b1: 5c16 B:98-219 [316213]
    Other proteins in same PDB: d5c16a2, d5c16b2, d5c16c2, d5c16d2
    automated match to d1lw3a1
    complexed with po4

Details for d5c16b1

PDB Entry: 5c16 (more details), 2.07 Å

PDB Description: myotubularin-related proetin 1
PDB Compounds: (B:) Myotubularin-related protein 1

SCOPe Domain Sequences for d5c16b1:

Sequence, based on SEQRES records: (download)

>d5c16b1 b.55.1.0 (B:98-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aplfpgesikaivkdvmyicpfmgavsgtltvtdfklyfknverdphfildvplgvisrv
ekigaqshgdnscgieivckdmrnlrlaykqeeqsklgifenlnkhafplsngqalfafs
yk

Sequence, based on observed residues (ATOM records): (download)

>d5c16b1 b.55.1.0 (B:98-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aplfpgesikaivkdvmyicpfmgavsgtltvtdfklyfknvhfildvplgvisrvekig
ieivckdmrnlrlaylgifenlnkhafplsngqalfafsyk

SCOPe Domain Coordinates for d5c16b1:

Click to download the PDB-style file with coordinates for d5c16b1.
(The format of our PDB-style files is described here.)

Timeline for d5c16b1: