Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries) |
Domain d5ec1c_: 5ec1 C: [316140] Other proteins in same PDB: d5ec1a1, d5ec1a2, d5ec1a3, d5ec1b1, d5ec1b2 automated match to d3stlc_ complexed with dga, f09, k; mutant |
PDB Entry: 5ec1 (more details), 2.75 Å
SCOPe Domain Sequences for d5ec1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ec1c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattxgygdl cpvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d5ec1c_: