Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) automatically mapped to Pfam PF00632 |
Family d.148.1.0: automated matches [227207] (1 protein) not a true family |
Protein automated matches [226939] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225255] (18 PDB entries) |
Domain d5hptd_: 5hpt D: [316127] Other proteins in same PDB: d5hptb_, d5hptc_, d5hpte_, d5hptf_, d5hpth_ automated match to d4y07a_ |
PDB Entry: 5hpt (more details), 2.84 Å
SCOPe Domain Sequences for d5hptd_:
Sequence, based on SEQRES records: (download)
>d5hptd_ d.148.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrgee gldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrfi amalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemyf svdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnevv plqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqfvketdnevrm rllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksyeq lkekllfaieete
>d5hptd_ d.148.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrgee gldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrfi amalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemyf svdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnevv plqwlqyfdekelevmlcgmevdladwqrntvyrhtrnskqiiwfwqfvketdnevrmrl lqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksyeqlk ekllfaieete
Timeline for d5hptd_: