Lineage for d5hpta_ (5hpt A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548233Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 2548234Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 2548250Family d.148.1.0: automated matches [227207] (1 protein)
    not a true family
  6. 2548251Protein automated matches [226939] (2 species)
    not a true protein
  7. 2548255Species Human (Homo sapiens) [TaxId:9606] [225255] (16 PDB entries)
  8. 2548271Domain d5hpta_: 5hpt A: [316098]
    Other proteins in same PDB: d5hptb_, d5hptc_, d5hpte_, d5hptf_, d5hpth_
    automated match to d4y07a_

Details for d5hpta_

PDB Entry: 5hpt (more details), 2.84 Å

PDB Description: system-wide modulation of hect e3 ligases with selective ubiquitin variant probes: wwp1, ubv p2.3 and ubch7
PDB Compounds: (A:) NEDD4-like E3 ubiquitin-protein ligase WWP1

SCOPe Domain Sequences for d5hpta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpta_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrgee
gldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrfi
amalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemyf
svdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnevv
plqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqfvketdnevrm
rllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksyeq
lkekllfaieete

SCOPe Domain Coordinates for d5hpta_:

Click to download the PDB-style file with coordinates for d5hpta_.
(The format of our PDB-style files is described here.)

Timeline for d5hpta_: