SCOPe 2.08: Domain d5ec2b1: 5ec2 B:1-107

Lineage for d5ec2b1 (5ec2 B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (231 PDB entries)
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

8. Domain d5ec2b1: 5ec2 B:1-107 [316082]
   Other proteins in same PDB: d5ec2a1, d5ec2a2, d5ec2a3, d5ec2b2, d5ec2c_
   automated match to d1r3ja1
   complexed with dga, f09, k; mutant

Details for d5ec2b1

PDB Entry: 5ec2, 2.3 Å

PDB Description: kcsa with v76ester+g77da mutations

PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d5ec2b1:

Sequence; same for both SEQRES and ATOM records:

>d5ec2b1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

Timeline for d5ec2b1:

• d5ec2b1 first appeared in SCOPe 2.06
  
• d5ec2b1 appears in SCOPe 2.07