SCOPe 2.06: Domain d5d3yb_: 5d3y B:

Lineage for d5d3yb_ (5d3y B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)

8. Domain d5d3yb_: 5d3y B: [316048]
   automated match to d1pmsa_
   complexed with 4ip

Details for d5d3yb_

PDB Entry: 5d3y, 1.95 Å

PDB Description: crystal structure of the p-rex1 ph domain with inositol-(1,3,4,5)- tetrakisphosphate bound

PDB Compounds: (B:) Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein

SCOPe Domain Sequences for d5d3yb_:

Sequence, based on SEQRES records:

>d5d3yb_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aleqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrksrvt
gskkstkrtksingslyifrgrintevmevenvedgtadyhsngytvtngwkihntaknk
wfvcmaktaeekqkwldaiirereqreslkl

Sequence, based on observed residues (ATOM records):

>d5d3yb_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aleqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrksrvs
lyifrgrintevmevenvedgtadyhsngytvtngwkihntaknkwfvcmaktaeekqkw
ldaiirereqreslkl

Timeline for d5d3yb_:

• d5d3yb_ is new in SCOPe 2.06-stable
  
• d5d3yb_ appears in SCOPe 2.07
  
• d5d3yb_ appears in the current release, SCOPe 2.08