Lineage for d1b6ta_ (1b6t A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119196Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2119314Protein Phosphopantetheine adenylyltransferase [52398] (6 species)
  7. 2119317Species Escherichia coli [TaxId:562] [52399] (4 PDB entries)
  8. 2119320Domain d1b6ta_: 1b6t A: [31600]
    complexed with cod, so4

Details for d1b6ta_

PDB Entry: 1b6t (more details), 1.8 Å

PDB Description: phosphopantetheine adenylyltransferase in complex with 3'-dephospho-coa from escherichia coli
PDB Compounds: (A:) protein (phosphopantetheine adenylyltransferase)

SCOPe Domain Sequences for d1b6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ta_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d1b6ta_:

Click to download the PDB-style file with coordinates for d1b6ta_.
(The format of our PDB-style files is described here.)

Timeline for d1b6ta_: