Lineage for d1coza_ (1coz A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68936Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 68937Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 68996Family c.26.1.2: Cytidylyltransferase [52394] (1 protein)
  6. 68997Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species)
  7. 68998Species Bacillus subtilis [TaxId:1423] [52396] (1 PDB entry)
  8. 68999Domain d1coza_: 1coz A: [31598]

Details for d1coza_

PDB Entry: 1coz (more details), 2 Å

PDB Description: ctp:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis

SCOP Domain Sequences for d1coza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis}
mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
kikeei

SCOP Domain Coordinates for d1coza_:

Click to download the PDB-style file with coordinates for d1coza_.
(The format of our PDB-style files is described here.)

Timeline for d1coza_: