Lineage for d5iaoc_ (5iao C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891731Protein automated matches [190074] (15 species)
    not a true protein
  7. 2891767Species Mycobacterium tuberculosis [TaxId:419947] [315048] (1 PDB entry)
  8. 2891770Domain d5iaoc_: 5iao C: [315635]
    automated match to d1w30a_
    complexed with urf; mutant

Details for d5iaoc_

PDB Entry: 5iao (more details), 2.6 Å

PDB Description: structure and mapping of spontaneous mutational sites of pyrr from mycobacterium tuberculosis
PDB Compounds: (C:) Bifunctional protein PyrR

SCOPe Domain Sequences for d5iaoc_:

Sequence, based on SEQRES records: (download)

>d5iaoc_ c.61.1.1 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
esrelmsaadvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
eysgihvghgalditlyrddlmikpprplastsipaggiddalvilvddvlysgrsvrsa
ldalrdvgrpravqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvi
sr

Sequence, based on observed residues (ATOM records): (download)

>d5iaoc_ c.61.1.1 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
esrelmsaadvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
eysgihvghgalditlyrdstsipaggiddalvilvddvlysgrsvrsaldalrdvgrpr
avqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvisr

SCOPe Domain Coordinates for d5iaoc_:

Click to download the PDB-style file with coordinates for d5iaoc_.
(The format of our PDB-style files is described here.)

Timeline for d5iaoc_: